PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.H01521.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 383aa    MW: 39336.3 Da    PI: 7.9369
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.H01521.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.7e-3286141359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     +vrY+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e ++
  Pahal.H01521.3  86 AVRYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKEADD 141
                     79**************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.9E-2987139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.0E-3088138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2388139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.73589138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.1E-31248320IPR009057Homeodomain-like
SuperFamilySSF466891.03E-20249318IPR009057Homeodomain-like
TIGRFAMsTIGR015655.1E-27260316IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDLSGTQGEL AIPRHANVVV SPYGAGVGGG SAGGHVLQLH HGNNNGQSPA LPPSPPAAPA  60
EEMESSGKKR GLAAGAGIGG GGGSAAVRYR ECLKNHAAAI GGNATDGCGE FMPSGEEGSL  120
EALKCSACGC HRNFHRKEAD DDDDVDMYAV GDGFGRGHGP RAAHRLLAPA LPHHSKGGSG  180
GGLLVSAADP YGAYAAARAL PPALPPPGHG HGHVHHLPHH QYVMPLNMMH TGSESDDMDG  240
GAAGGGDAER GGSGGSSSSK KRFRTKFTPE QKARMLEFAE RVGWRLQKLD DGMVQAFCQE  300
IGVKRRVLKV WMHNNKHNLA TKRLETSPQE QPAVAAAMAS PPAPPQMPLQ MMPAGMMPPP  360
PQAAGPSCLR GGPGSPPPPK LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-242593181675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008678039.11e-143PREDICTED: zinc-finger homeodomain protein 4-like isoform X1
RefseqXP_008678040.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
RefseqXP_008678041.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
RefseqXP_008678042.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
RefseqXP_008678044.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
RefseqXP_008678045.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
RefseqXP_008678046.11e-144PREDICTED: zinc-finger homeodomain protein 4-like isoform X2
SwissprotQ53N871e-93ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLK7TV961e-144K7TV96_MAIZE; Putative homeobox DNA-binding domain superfamily protein isoform 1
TrEMBLK7TRK31e-143K7TRK3_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G068330_P021e-143(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-27homeobox protein 31